Recombinant Human Galectin 2 protein (ab99239)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTGELEVKNMDMKPGSTLKITGSIADGTDG FVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGS EVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKL KE
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 132
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99239 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Beta galactoside binding lectin L14 II
    • Beta-galactoside-binding lectin L-14-II
    • CBP35
    • Gal-2
    • GAL3
    • GALBP
    • Galectin 2
    • Galectin-2
    • GALIG
    • HL14
    • Lactose binding lectin 2
    • Lactose-binding lectin 2
    • LEG2_HUMAN
    • LGALS2
    • MAC2
    • S Lac lectin 2
    • S-Lac lectin 2
    see all
  • Function
    This protein binds beta-galactoside. Its physiological function is not yet known.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99239 at approximately 16.8kDa (3µg).

References

ab99239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up