Recombinant Human Galectin 2 protein (ab99239)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTGELEVKNMDMKPGSTLKITGSIADGTDG FVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGS EVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKL KE
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 132
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99239 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Beta galactoside binding lectin L14 II
    • Beta-galactoside-binding lectin L-14-II
    • CBP35
    • Gal-2
    • GAL3
    • GALBP
    • Galectin 2
    • Galectin-2
    • GALIG
    • HL14
    • Lactose binding lectin 2
    • Lactose-binding lectin 2
    • LEG2_HUMAN
    • LGALS2
    • MAC2
    • S Lac lectin 2
    • S-Lac lectin 2
    see all
  • Function
    This protein binds beta-galactoside. Its physiological function is not yet known.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

Recombinant Human Galectin 2 protein images

  • 15% SDS-PAGE showing ab99239 at approximately 16.8kDa (3µg).

References for Recombinant Human Galectin 2 protein (ab99239)

ab99239 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up