Recombinant Human Galectin 8 protein (ab99294)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO00214
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMMLSLNNLQNIIYNPVIPFVGTIPDQLDPG TLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNT LINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRI GPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHL NPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKV AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
    • Molecular weight38 kDa including tags
    • Amino acids1 to 317
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99294 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Gal 8
    • Gal-8
    • Gal8
    • Galectin-8
    • galectin-8g
    • Lectin galactoside binding soluble 8
    • LEG8_HUMAN
    • LGAL S8
    • Lgals8
    • PCTA 1
    • PCTA-1
    • PCTA1
    • Po66 carbohydrate binding protein
    • Po66 carbohydrate-binding protein
    • Po66 CBP
    • Po66-CBP
    • Prostate carcinoma tumor antigen 1
    see all
  • Tissue specificityUbiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
  • Sequence similaritiesContains 2 galectin domains.
  • DomainContains two homologous but distinct carbohydrate-binding domains.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Galectin 8 protein images

  • 15% SDS-PAGE showing ab99294 (3µg).

References for Recombinant Human Galectin 8 protein (ab99294)

ab99294 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"