Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEH IDYCGYSVLPMAVEQDVLIAVEPVKTYALQLANTNPLYPDFSTSANNIQI DKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSAL VCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEG TAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLA AKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEI CRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLT GAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGG GALVL LEAVDHHHHHH
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 458
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab191805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by RP-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names
    • GALK2
    • GaINAc Kinase
    • Galactokinase 2
    • Galk2
    • GALK2_HUMAN
    • GalNAc kinase
    • GK2
    • MGC1745
    • N-acetylgalactosamine kinase
    see all
  • Function
    Acts on GalNAc. Also acts as a galactokinase when galactose is present at high concentrations. May be involved in a salvage pathway for the reutilization of free GalNAc derived from the degradation of complex carbohydrates.
  • Sequence similarities
    Belongs to the GHMP kinase family. GalK subfamily.
  • Information by UniProt

References

ab191805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up