Recombinant Human GALNT1 protein (ab117036)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEM IALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
    • Molecular weight
      35 kDa including tags
    • Amino acids
      42 to 123

Specifications

Our Abpromise guarantee covers the use of ab117036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GALNAC T1
    • GalNAc transferase 1
    • GalNAc-T1
    • GALNT 1
    • GALNT1
    • GALT1_HUMAN
    • Polypeptide GalNAc transferase 1
    • Polypeptide N acetylgalactosaminyltransferase 1
    • Polypeptide N-acetylgalactosaminyltransferase 1 soluble form
    • pp GaNTase 1
    • pp-GaNTase 1
    • Protein UDP acetylgalactosaminyltransferase 1
    • Protein-UDP acetylgalactosaminyltransferase 1
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 1
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1 (GalNAc T1)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.
  • Tissue specificity
    Widely expressed. Expressed in all tissues tested.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain directs the glycopeptide specificity. It is required in the glycopeptide specificity of enzyme activity but not for activity with naked peptide substrates, suggesting that it triggers the catalytic domain to act on GalNAc-glycopeptide substrates.
  • Cellular localization
    Secreted and Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117036 at approximately 34.65 kDa.

References

ab117036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up