Recombinant Human GALNT2 protein (ab114957)

Overview

  • Product name
    Recombinant Human GALNT2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKW EQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      473 to 571

Specifications

Our Abpromise guarantee covers the use of ab114957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GalNAc T2
    • GalNAc-T2
    • Galnt2
    • GALT2_HUMAN
    • GaNTase 2
    • Polypeptide GalNAc transferase 2
    • Polypeptide N acetylgalactosaminyltransferase 2
    • Polypeptide N acetylgalactosaminyltransferase 2 soluble form
    • Polypeptide N-acetylgalactosaminyltransferase 2 soluble form
    • pp GaNTase 2
    • pp-GaNTase 2
    • Protein UDP acetylgalactosaminyltransferase 2
    • Protein-UDP acetylgalactosaminyltransferase 2
    • UDP GalNAc transferase 2
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2 (GalNAc T2)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Secreted. Resides preferentially in the trans and medial parts of the Golgi stack. A secreted form also exists.
  • Information by UniProt

Recombinant Human GALNT2 protein images

  • 12.5% SDS-PAGE showing ab114957 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GALNT2 protein (ab114957)

ab114957 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up