Recombinant Human GALNT2 protein (ab114957)

Overview

  • Product name
    Recombinant Human GALNT2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKW EQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
    • Molecular weight
      37 kDa including tags
    • Amino acids
      473 to 571

Specifications

Our Abpromise guarantee covers the use of ab114957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GalNAc T2
    • GalNAc-T2
    • Galnt2
    • GALT2_HUMAN
    • GaNTase 2
    • Polypeptide GalNAc transferase 2
    • Polypeptide N acetylgalactosaminyltransferase 2
    • Polypeptide N acetylgalactosaminyltransferase 2 soluble form
    • Polypeptide N-acetylgalactosaminyltransferase 2 soluble form
    • pp GaNTase 2
    • pp-GaNTase 2
    • Protein UDP acetylgalactosaminyltransferase 2
    • Protein-UDP acetylgalactosaminyltransferase 2
    • UDP GalNAc transferase 2
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2 (GalNAc T2)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Secreted. Resides preferentially in the trans and medial parts of the Golgi stack. A secreted form also exists.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114957 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References

ab114957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up