Recombinant Human GALNT4 protein (ab160144)

Overview

  • Product name
    Recombinant Human GALNT4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RARELGSRRLSGLQKNTEDLSRPLYKKPPADSRALGEWGKASKLQLNEDE LKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQKFNYRTLPTTSV IIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETY ISNLDRVRLIRTNKREGLVRARLIGATFATGDVLTFLDCHCECNSGWLEP LLERIGRDETAVVCPVIDTIDWNTFEFYMQIGEPMIGGFDWRLTFQWHSV PKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENL ELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDE YKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFPNLHVPE DRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQFFEYT SNKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTI FHPHSGLCLSAYRTPEGRPDVQMRTCDALDKNQIWSFEK
    • Amino acids
      40 to 578
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.4.1.41
    • GALNAC T4
    • GalNAc transferase 4
    • GalNAc-T4
    • GalNAcT4
    • GALNT4
    • GALT4_HUMAN
    • N-acetylgalactosaminyltransferase 4 (GalNAc-T4)
    • Polypeptide GalNAc transferase 4
    • Polypeptide N-acetylgalactosaminyltransferase 4
    • pp GaNTase 4
    • pp-GaNTase 4
    • Protein UDP acetylgalactosaminyltransferase 4
    • Protein-UDP acetylgalactosaminyltransferase 4
    • UDP GalNAc:polypeptide N-acetylgalactosaminyltransferase 4
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a highest activity toward Muc7, EA2 and Muc2, with a lowest activity than GALNT2. Glycosylates 'Thr-57' of SELPLG.
  • Tissue specificity
    Ubiquitous. Highly expressed in mucous cells.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain directs the glycopeptide specificity. It is required in the glycopeptide specificity of enzyme activity but not for activity with naked peptide substrates, suggesting that it triggers the catalytic domain to act on GalNAc-glycopeptide substrates.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160144 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up