Recombinant Human GALNT6 protein (ab161356)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRK DHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELK PFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKHCFNAFASDRI SLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSV LHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLI TARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIK SPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEII PCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQA AKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGA IKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAK QLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTS QDKKPAMAPCNPSDPHQLWLFV
    • Amino acids
      1 to 622
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GALNAC T6
    • GalNAc transferase 6
    • GalNAc-T6
    • GalNAcT6
    • GALNT 6
    • GALNT6
    • GALT6_HUMAN
    • Polypeptide GalNAc transferase 6
    • Polypeptide N acetylgalactosaminyltransferase 6
    • Polypeptide N-acetylgalactosaminyltransferase 6
    • pp GaNTase 6
    • pp-GaNTase 6
    • Protein UDP acetylgalactosaminyltransferase 6
    • Protein-UDP acetylgalactosaminyltransferase 6
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 6
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 6
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 6 (GalNAc T6)
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
    see all
  • Function
    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides.
  • Tissue specificity
    Expressed in placenta and trachea. Weakly expressed in brain and pancreas. Expressed in fibroblast. Weakly or not expressed in lung, liver, muscle, kidney, spleen, thymus, prostate, testis, ovary, intestine, colon, leukocyte, stomach, thyroid, spinal cord, lymph node, trachea, adrenal gland and bone marrow.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up