Recombinant Human gamma Adducin protein (ab116814)

Overview

  • Product nameRecombinant Human gamma Adducin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UEY8
    • SpeciesHuman
    • SequencePRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQ NRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG
    • Molecular weight37 kDa including tags
    • Amino acids462 to 560

Specifications

Our Abpromise guarantee covers the use of ab116814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ADD3
    • ADDG_HUMAN
    • ADDL
    • Adducin 3
    • Adducin 3 (gamma)
    • Adducin, gamma
    • Adducin-like
    • Adducin-like protein 70
    • Gamma-adducin
    see all
  • FunctionMembrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.
  • Tissue specificityHeart only expresses isoform 1.
  • Sequence similaritiesBelongs to the aldolase class II family. Adducin subfamily.
  • DomainComprised of three regions: a N-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localizationCytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt

Recombinant Human gamma Adducin protein images

  • 12.5% SDS-PAGE showing ab116814 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human gamma Adducin protein (ab116814)

ab116814 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"