Recombinant Human gamma Adducin protein (ab116814)

Overview

  • Product name
    Recombinant Human gamma Adducin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQ NRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      462 to 560

Specifications

Our Abpromise guarantee covers the use of ab116814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ADD3
    • ADDG_HUMAN
    • ADDL
    • Adducin 3
    • Adducin 3 (gamma)
    • Adducin, gamma
    • Adducin-like
    • Adducin-like protein 70
    • Gamma-adducin
    see all
  • Function
    Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.
  • Tissue specificity
    Heart only expresses isoform 1.
  • Sequence similarities
    Belongs to the aldolase class II family. Adducin subfamily.
  • Domain
    Comprised of three regions: a N-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116814 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References

ab116814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up