Recombinant Human gamma C Crystallin protein (ab117015)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP07315
    • SpeciesHuman
    • SequenceSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSL HVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
    • Molecular weight37 kDa including tags
    • Amino acids75 to 174

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CATARACT, VARIABLE ZONULAR PULVERULENT
    • CCL
    • CRGC_HUMAN
    • Cryg
    • CRYG 3
    • Cryg 5
    • CRYG3
    • CRYGC
    • Crystallin gamma 3
    • Crystallin gamma C
    • Gamma C crystallin
    • Gamma crystallin 2 1
    • Gamma crystallin 3
    • Gamma crystallin C
    • Gamma-C-crystallin
    • Gamma-crystallin 2-1
    • Gamma-crystallin 3
    • Gamma-crystallin C
    • Gammab cry
    • Len
    see all
  • FunctionCrystallins are the dominant structural components of the vertebrate eye lens.
  • Involvement in diseaseDefects in CRYGC are a cause of cataract autosomal dominant (ADC) [MIM:604219]. Cataract is an opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. Cataract is the most common treatable cause of visual disability in childhood.
    Defects in CRYGC are a cause of cataract Coppock-like (CCL) [MIM:604307]. A congenital pulverulent disk-like opacity involving the embryonic nucleus with many tiny white dots in the lamellar portion of the lens. It is usually bilateral and dominantly inherited.
  • Sequence similaritiesBelongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • DomainHas a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Information by UniProt

Recombinant Human gamma C Crystallin protein images

  • 12.5% SDS-PAGE showing ab117015 at approximately 36.63 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human gamma C Crystallin protein (ab117015)

ab117015 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"