Recombinant Human gamma Sarcoglycan protein (ab114962)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13326
    • SpeciesHuman
    • SequenceMVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVN LALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVD SSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPL FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS LSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQG TWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
    • Molecular weight58 kDa including tags
    • Amino acids1 to 291

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 35 kDa dystrophin associated glycoprotein
    • 35 kDa dystrophin-associated glycoprotein
    • 35DAG
    • 35kD dystrophin associated glycoprotein
    • 35kDa dystrophin-associated glycoprotein
    • A4
    • DAGA4
    • DMDA
    • DMDA1
    • Gamma SG
    • Gamma-sarcoglycan
    • Gamma-SG
    • LGMD2C
    • MAM
    • MGC130048
    • Sarcoglycan gamma
    • SCARMD2
    • SCG3
    • SGCG
    • SGCG_HUMAN
    • TYPE
    see all
  • FunctionComponent of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificityExpressed in skeletal and heart muscle.
  • Involvement in diseaseDefects in SGCG are the cause of limb-girdle muscular dystrophy type 2C (LGMD2C) [MIM:253700]. LGMD2C is characterized by progressive muscle wasting from early childhood.
  • Sequence similaritiesBelongs to the sarcoglycan beta/delta/gamma/zeta family.
  • Cellular localizationCell membrane > sarcolemma. Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human gamma Sarcoglycan protein images

  • 12.5% SDS-PAGE showing ab114962 at approximately 58.08kDa.
    Stained with Coomassie Blue.

References for Recombinant Human gamma Sarcoglycan protein (ab114962)

ab114962 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"