Recombinant Human gamma Sarcoglycan protein (ab114963)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      191 to 290

Specifications

Our Abpromise guarantee covers the use of ab114963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 35 kDa dystrophin associated glycoprotein
    • 35 kDa dystrophin-associated glycoprotein
    • 35DAG
    • 35kD dystrophin associated glycoprotein
    • 35kDa dystrophin-associated glycoprotein
    • A4
    • DAGA4
    • DMDA
    • DMDA1
    • Gamma SG
    • Gamma-sarcoglycan
    • Gamma-SG
    • LGMD2C
    • MAM
    • MGC130048
    • Sarcoglycan gamma
    • SCARMD2
    • SCG3
    • SGCG
    • SGCG_HUMAN
    • TYPE
    see all
  • Function
    Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificity
    Expressed in skeletal and heart muscle.
  • Involvement in disease
    Defects in SGCG are the cause of limb-girdle muscular dystrophy type 2C (LGMD2C) [MIM:253700]. LGMD2C is characterized by progressive muscle wasting from early childhood.
  • Sequence similarities
    Belongs to the sarcoglycan beta/delta/gamma/zeta family.
  • Cellular localization
    Cell membrane > sarcolemma. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114963 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up