Recombinant Human gamma Synuclein protein (ab169723)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQ SVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDL RPSAPQQEGEASKEKEEVAEEAQSGGD
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 127
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.76% Sodium chloride

General Info

  • Alternative names
    • BCSG1
    • Breast cancer specific gene 1 protein
    • Breast cancer specific protein 1
    • Breast cancer-specific gene 1 protein
    • Gamma synuclein
    • Gamma-synuclein
    • Persyn
    • PRSN
    • SNCG
    • SR
    • Synoretin
    • Synuclein gamma
    • synuclein, gamma (breast cancer-specific protein 1)
    • SYUG_HUMAN
    see all
  • Function
    Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
  • Tissue specificity
    Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
  • Sequence similarities
    Belongs to the synuclein family.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases.
  • Cellular localization
    Cytoplasm > perinuclear region. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
  • Information by UniProt

Images

  • The purity of ab169723 was determined by SDS-PAGE.

References

ab169723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up