Recombinant Human gamma Tubulin protein (denatured) (ab115710)

Overview

  • Product name
    Recombinant Human gamma Tubulin protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human gamma Tubulin protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPREIITLQLGQCGNQIGFEFWKQLCAEHG ISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNS PYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSD SLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQ LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDP TQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMAN HTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQ LIDEYHAATRPDYISWGTQEQ
    • Molecular weight
      53 kDa including tags
    • Amino acids
      1 to 451
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 6% Urea, 5% Glycerol

General Info

  • Alternative names
    • Gamma 1 tubulin
    • Gamma 2 tubulin
    • Gamma Tubulin 1
    • Gamma Tubulin 2
    • Gamma tubulin complex component 1
    • Gamma-2-tubulin
    • GCP 1
    • GCP1
    • MGC131994
    • TBG2_HUMAN
    • TUBG
    • TUBG1
    • TUBG2
    • TUBGCP1
    • Tubulin gamma 1 chain
    • Tubulin gamma 2 chain
    • Tubulin gamma complex-associated protein 1
    • Tubulin gamma-2 chain
    • tubulin, gamma 1
    • tubulin, gamma 2
    • tubulin, gamma polypeptide
    • Xgam
    see all
  • Function
    Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta tubulin minus-end nucleation, centrosome duplication and spindle formation.
  • Sequence similarities
    Belongs to the tubulin family.
  • Post-translational
    modifications
    Phosphorylation at Ser-131 by BRSK1 regulates centrosome duplication, possibly by mediating relocation of gamma-tubulin and its associated proteins from the cytoplasm to the centrosome.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115710 at approximately 53.3kDa (3µg).

References

ab115710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your enquiry and your interest in our products.

The Lab has retested this protein and it is very likely that the higher band at 100 kDa represents the multimer forms. I have attached the image to this response and hope that you ...

Read More

I am sorry to hear that you have been experiencing problems using this product in the application that you wish.

Please could you provide some further details of the protocol used and complete the following form (attached as a word document)....

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up