Recombinant Human gamma Tubulin protein (denatured) (ab115710)

Overview

  • Product nameRecombinant Human gamma Tubulin protein (denatured)
  • Protein lengthFull length protein
  • Description
    Recombinant Human gamma Tubulin protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP23258
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPREIITLQLGQCGNQIGFEFWKQLCAEHG ISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNS PYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSD SLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQ LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDP TQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMAN HTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQ LIDEYHAATRPDYISWGTQEQ
    • Molecular weight53 kDa including tags
    • Amino acids1 to 451
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 6% Urea, 5% Glycerol

General Info

  • Alternative names
    • Gamma 1 tubulin
    • Gamma 2 tubulin
    • Gamma Tubulin 1
    • Gamma Tubulin 2
    • Gamma tubulin complex component 1
    • Gamma-2-tubulin
    • GCP 1
    • GCP1
    • MGC131994
    • TBG2_HUMAN
    • TUBG
    • TUBG1
    • TUBG2
    • TUBGCP1
    • Tubulin gamma 1 chain
    • Tubulin gamma 2 chain
    • Tubulin gamma complex-associated protein 1
    • Tubulin gamma-2 chain
    • tubulin, gamma 1
    • tubulin, gamma 2
    • tubulin, gamma polypeptide
    • Xgam
    see all
  • FunctionTubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta tubulin minus-end nucleation, centrosome duplication and spindle formation.
  • Sequence similaritiesBelongs to the tubulin family.
  • Post-translational
    modifications
    Phosphorylation at Ser-131 by BRSK1 regulates centrosome duplication, possibly by mediating relocation of gamma-tubulin and its associated proteins from the cytoplasm to the centrosome.
  • Cellular localizationCytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Recombinant Human gamma Tubulin protein (denatured) images

  • 15% SDS-PAGE showing ab115710 at approximately 53.3kDa (3µg).

References for Recombinant Human gamma Tubulin protein (denatured) (ab115710)

ab115710 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry and your interest in our products.

The Lab has retested this protein and it is very likely that the higher band at 100 kDa represents the multimer forms. I have attached the image to this response and hope that you ...

Read More

I am sorry to hear that you have been experiencing problems using this product in the application that you wish.

Please could you provide some further details of the protocol used and complete the following form (attached as a word document)....

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"