Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKK LKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDE PGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDN SPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 238

Specifications

Our Abpromise guarantee covers the use of ab114188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Axonal membrane protein GAP 43
    • Axonal membrane protein GAP-43
    • B 50
    • Calmodulin binding protein P 57
    • F1
    • GAP 43
    • GAP43
    • Growth Associated Protein 43
    • Growth-associated protein 43
    • Nerve Growth Related Peptide
    • Nerve growth related peptide GAP43
    • NEUM_HUMAN
    • Neural phosphoprotein B 50
    • Neural phosphoprotein B-50
    • Neuromodulin
    • Neuron growth associated protein 43
    • PP46
    • Protein F1
    • QtrA-11580
    • QtrA-13071
    see all
  • Function
    This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons.
  • Sequence similarities
    Belongs to the neuromodulin family.
    Contains 1 IQ domain.
  • Post-translational
    modifications
    Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.
  • Cellular localization
    Cell membrane. Cell projection > growth cone membrane. Cell junction > synapse. Cytoplasmic surface of growth cone and synaptic plasma membranes.
  • Information by UniProt

Recombinant Human GAP43 protein images

  • ab114188 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human GAP43 protein (ab114188)

ab114188 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up