Recombinant Human GAPDHS protein (ab161972)

Overview

  • Product name
    Recombinant Human GAPDHS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREE IKPPPPPLPPHPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVK VVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQC KEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAP MFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTV HSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLL RYMFSRDK
    • Amino acids
      1 to 408
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G3PT_HUMAN
    • GAPD2
    • GAPDH 2
    • GAPDH-2
    • GAPDH2
    • GAPDHS
    • GAPDS
    • Glyceraldehyde 3 phosphate dehydrogenase spermatogenic
    • Glyceraldehyde 3 phosphate dehydrogenase, testis specific
    • Glyceraldehyde-3-phosphate dehydrogenase
    • HSD 35
    • HSD35
    • Spermatogenic cell specific glyceraldehyde 3 phosphate dehydrogenase 2
    • Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2
    • Spermatogenic glyceraldehyde 3 phosphate dehydrogenase
    • Spermatogenic glyceraldehyde-3-phosphate dehydrogenase
    • testis-specific
    see all
  • Function
    May play an important role in regulating the switch between different pathways for energy production during spermiogenesis and in the spermatozoon. Required for sperm motility and male fertility.
  • Tissue specificity
    Testis specific.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 1/5.
  • Sequence similarities
    Belongs to the glyceraldehyde-3-phosphate dehydrogenase family.
  • Domain
    The testis-specific N-terminal extension mediates tight association with the cytoskeletal fibrous sheath of the spermatozoa flagellum, possibly via interchain disulfide-bonding of Cys-21 with sheath components.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161972 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up