Overview

  • Product name
    Recombinant Human GART protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAI SISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEA AQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKAS GLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSC LCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKI KDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQV ILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTK GVEITGFPEAQALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISAL EEAKKGLAAIKFEGAIYRKDVGFRAIAFLQQPR
    • Amino acids
      1 to 433
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5'-phosphoribosylglycinamide transformylase
    • AIR synthase
    • AIRS
    • GAR transformylase
    • GARS
    • GART
    • GARTF
    • Glycinamide ribonucleotide synthetase
    • MGC47764
    • PAIS
    • PGFT
    • Phosphoribosyl-aminoimidazole synthetase
    • Phosphoribosylglycinamide formyltransferase
    • Phosphoribosylglycinamide formyltransferase phosphoribosylglycinamide synthetase phosphoribosylaminoimidazole synthetase
    • Phosphoribosylglycinamide formyltransferase, EC 2.1.2.29
    • Phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
    • Phosphoribosylglycinamide synthetase
    • PRGS
    • PUR2_HUMAN
    • Trifunctional purine biosynthetic protein adenosine 3
    see all
  • Pathway
    Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole from N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamide: step 2/2.
    Purine metabolism; IMP biosynthesis via de novo pathway; N(1)-(5-phospho-D-ribosyl)glycinamide from 5-phospho-alpha-D-ribose 1-diphosphate: step 2/2.
    Purine metabolism; IMP biosynthesis via de novo pathway; N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamide from N(1)-(5-phospho-D-ribosyl)glycinamide (10-formyl THF route): step 1/1.
  • Sequence similarities
    In the N-terminal section; belongs to the GARS family.
    In the central section; belongs to the AIR synthase family.
    In the C-terminal section; belongs to the GART family.
    Contains 1 ATP-grasp domain.
  • Information by UniProt

Images

  • ab158498 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up