Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14393
    • SpeciesHuman
    • SequenceVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPD VPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA
    • Molecular weight37 kDa including tags
    • Amino acids622 to 721

Specifications

Our Abpromise guarantee covers the use of ab114494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris buffered saline

General Info

  • Alternative names
    • AXL receptor tyrosine kinase ligand
    • AXL stimulatory factor
    • AXLLG
    • AXS F
    • AXSF
    • DKFZp666G247
    • FLJ34709
    • Gas 6
    • GAS-6
    • Gas6
    • GAS6_HUMAN
    • Growth arrest specific 6
    • Growth arrest-specific protein 6
    • Growth-arrest-specific protein 6
    • Growth-arrest-specific protein 6 precursor
    see all
  • FunctionLigand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses.
  • Tissue specificityPlasma. Isoform 1 and isoform 2 are widely expressed. Isoform 1 is the predominant form in spleen.
  • Sequence similaritiesContains 4 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 laminin G-like domains.
  • Post-translational
    modifications
    Isoform 1 is proteolytically processed after secretion to yield a N-terminal 36 kDa protein and a C-terminal 50 kDa protein including the laminin G-like domains which activates AXL.
    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human GAS 6 protein images

  • 12.5% SDS-PAGE showing ab114494 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human GAS 6 protein (ab114494)

ab114494 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"