Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGK EITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT SAPSGSFFAR
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAS 2
    • GAS-2
    • Gas2
    • GAS2_HUMAN
    • Growth arrest specific 2
    • Growth arrest specific protein 2
    • Growth arrest-specific protein 2
    • MGC32610
    see all
  • Function
    May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process.
  • Tissue specificity
    Ubiquitously expressed with highest levels in liver, lung, and kidney. Not found in spleen.
  • Sequence similarities
    Belongs to the GAS2 family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 GAR domain.
  • Developmental stage
    Specifically expressed at growth arrest.
  • Post-translational
    modifications
    Cleaved, during apoptosis, on a specific aspartic residue by caspases.
    Phosphorylated on serine residues during the G0-G1 transition phase.
  • Cellular localization
    Cytoplasm > cytoskeleton. Membrane. Component of the microfilament system. Colocalizes with actin fibers at the cell border and along the stress fibers in growth-arrested fibroblasts. Mainly membrane-associated. When hyperphosphorylated, accumulates at membrane ruffles.
  • Information by UniProt

Images

  • ab158500 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up