Overview

  • Product nameRecombinant Human GAS41 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95619
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMFKRMAEFGPDSGGRVKGVTIVKPIVY GNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNP LRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNA MLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEV KTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
    • Molecular weight29 kDa including tags
    • Amino acids1 to 227
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116188 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.03% DTT, 1.17% Sodium chloride, 0.002% PMSF

General Info

  • Alternative names
    • 4930573H17Rik
    • B230215M10Rik
    • GAS 41
    • Gas41
    • glioma amplified sequence 41
    • Glioma-amplified sequence 41
    • glioma-amplified sequence-41
    • gliomaamplified sequence 41
    • gliomaamplified sequence41
    • NUBI 1
    • NuBI-1
    • NuBI1
    • NuMA binding protein 1
    • NuMA-binding protein 1
    • YAF9
    • YEATS domain containing 4
    • YEATS domain containing4
    • YEATS domain-containing protein 4
    • YEATS4
    • YETS4_HUMAN
    see all
  • FunctionComponent of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
  • Tissue specificityExpressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
  • Sequence similaritiesContains 1 YEATS domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GAS41 protein images

  • ab116188 (3µg) analysed on a 15% SDS-PAGE gel.

References for Recombinant Human GAS41 protein (ab116188)

ab116188 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"