Recombinant Human Gastrin Releasing Peptide protein (ab158593)

Overview

  • Product name
    Recombinant Human Gastrin Releasing Peptide protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLM GKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQ PKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
    • Amino acids
      1 to 148
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BN
    • Bombesin
    • GRP
    • GRP-10
    • GRP_HUMAN
    • GRP10
    • Neuromedin-C
    • NeuromedinC
    • Pre progastrin releasing peptide
    • PreproGRP
    • ProGRP
    see all
  • Function
    GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent memory for fear.
  • Sequence similarities
    Belongs to the bombesin/neuromedin-B/ranatensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158593 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up