Recombinant Human Gastrokine 2 protein (BSA and azide free) (ab178468)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSS TTIFDYKHGYIASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNM FSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENTHNV GAGGCAKAGLLGILGISICADIHV
    • Molecular weight
      20 kDa including tags
    • Amino acids
      21 to 184
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab178468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 90 % Densitometry.
    ab178468 is purifed using Ni-NTA chromatography and filtered (0.4 µm).
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • BLOT
    • Blottin
    • BRICD1B
    • BRICHOS domain containing 1B
    • Down regulated in gastric cancer GDDR
    • Down-regulated in gastric cancer
    • Gastrokine-2
    • GDDR
    • Gkn2
    • GKN2_HUMAN
    • PRO813
    • TFIZ1
    • Trefoil factor interactions(z) 1
    • UNQ465/PRO813
    • VLTI465
    see all
  • Tissue specificity
    Expressed in gastric mucosa.
  • Sequence similarities
    Contains 1 BRICHOS domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab178468

    1) Reduced and boiled sample, 2.5 μg/lane

    2) Non-reduced and non-boiled sample, 2.5 μg/lane.

References

ab178468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up