Recombinant Human GATA1 protein (ab204189)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human GATA1 protein -
Purity
> 90 % SDS-PAGE.
ab204189 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHENLYFQGEFPGLGSLGTSEPLPQFVDPALVS STPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLD GKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSP TGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASG DPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTG AAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS -
Predicted molecular weight
46 kDa including tags -
Amino acids
2 to 413 -
Additional sequence information
Expressed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal. Accession Number: NP_002040
-
Associated products
-
Related Products
- Anti-GATA1 antibody (ab11852)
- Anti-TEV Tag antibody [KT88] (ab179875)
- Anti-GATA1 antibody [EPR17362] - ChIP Grade (ab181544)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-GATA1 antibody (ab28839)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-6X His tag® antibody (ab9108)
- Anti-T7 tag® antibody (ab9115)
Specifications
Our Abpromise guarantee covers the use of ab204189 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.
General Info
-
Alternative names
- Anemia, X-linked, without thrombocytopenia, included
- ERYF 1
- Eryf1
see all -
Function
Transcriptional activator which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence [AT]GATA[AG] within regulatory regions of globin genes and of other genes expressed in erythroid cells. -
Tissue specificity
Erythrocytes. -
Involvement in disease
Defects in GATA1 are the cause of X-linked dyserythropoietic anemia and thrombocytopenia (XDAT) [MIM:300367]. XDAT is a disorder characterized by erythrocytes with abnormal size and shape, and paucity of platelets in peripheral blood. The bone marrow contains abundant and abnormally small megakaryocytes.
Defects in GATA1 are the cause of X-linked thrombocytopenia with beta-thalassemia (XLTT) [MIM:314050]; also knwon as thrombocytopenia, platelet dysfunction, hemolysis, and imbalanced globin synthesis. XLTT consists of an unusual form of thrombocytopenia with beta-thalassemia. Patients have splenomegaly and petechiae, moderate thrombocytopenia, prolonged bleeding time due to platelet dysfunction, reticulocytosis and unbalanced hemoglobin chain synthesis resembling that of beta-thalassemia minor.
Defects in GATA1 are the cause of anemia without thrombocytopenia X-linked (XLAWT) [MIM:300835]. XLAWT is a form of anemia characterized by abnormal morphology of erythrocytes and granulocytes in peripheral blood, bone marrow dysplasia with hypocellularity of erythroid and granulocytic lineages, and normal or increased number of megakaryocytes. Neutropenia of a variable degree is present in affected individuals. -
Sequence similarities
Contains 2 GATA-type zinc fingers. -
Domain
The two fingers are functionally distinct and cooperate to achieve specific, stable DNA binding. The first finger is necessary only for full specificity and stability of binding, whereas the second one is required for binding. -
Post-translational
modificationsHighly phosphorylated on serine residues. Phosphorylation on Ser-310 is enhanced on erythroid differentiation. Phosphorylation on Ser-142 promotes sumoylation on Lys-137.
Sumoylation on Lys-137 is enhanced by phosphorylation on Ser-142 and by interaction with PIAS4. Sumoylation by SUMO1 has no effect on transcriptional activity. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab204189 has not yet been referenced specifically in any publications.