Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23769
    • SpeciesHuman
    • SequenceMEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFN HLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDG GK
    • Molecular weight37 kDa including tags
    • Amino acids1 to 102

Specifications

Our Abpromise guarantee covers the use of ab114361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCML
    • Endothelial transcription factor GATA 2
    • Endothelial transcription factor GATA-2
    • Endothelial transcription factor GATA2
    • FLJ45948
    • GATA 2
    • GATA binding protein 2
    • GATA-binding protein 2
    • Gata2
    • GATA2_HUMAN
    • IMD21
    • MGC2306
    • MONOMAC
    • NFE 1B
    • NFE1B
    • OTTHUMP00000216240
    see all
  • FunctionTranscriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificityEndothelial cells.
  • Sequence similaritiesContains 2 GATA-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GATA2 protein images

  • 12.5% SDS-PAGE showing ab114361 at approximately 36.85kDa stained with Coomassie Blue.

References for Recombinant Human GATA2 protein (ab114361)

ab114361 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"