Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23771
    • SpeciesHuman
    • SequenceLGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFT FPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
    • Molecular weight36 kDa
    • Amino acids103 to 200
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: glutathione is reduced

General Info

  • Alternative names
    • GATA 3
    • GATA binding factor 3
    • GATA binding protein 3
    • GATA-binding factor 3
    • Gata3
    • GATA3_HUMAN
    • HDR
    • HDRS
    • MGC2346
    • MGC5199
    • MGC5445
    • Trans acting T cell specific transcription factor GATA 3
    • Trans-acting T-cell-specific transcription factor GATA-3
    see all
  • FunctionTranscriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificityT-cells and endothelial cells.
  • Involvement in diseaseDefects in GATA3 are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia (HDR) [MIM:146255]; also known as Barakat syndrome.
  • Sequence similaritiesContains 2 GATA-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GATA3 protein images

  • ab112288 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GATA3 protein (ab112288)

ab112288 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"