Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFT FPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
    • Molecular weight
      36 kDa
    • Amino acids
      103 to 200
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: glutathione is reduced

General Info

  • Alternative names
    • GATA 3
    • GATA binding factor 3
    • GATA binding protein 3
    • GATA-binding factor 3
    • Gata3
    • GATA3_HUMAN
    • HDR
    • HDRS
    • MGC2346
    • MGC5199
    • MGC5445
    • Trans acting T cell specific transcription factor GATA 3
    • Trans-acting T-cell-specific transcription factor GATA-3
    see all
  • Function
    Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificity
    T-cells and endothelial cells.
  • Involvement in disease
    Defects in GATA3 are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia (HDR) [MIM:146255]; also known as Barakat syndrome.
  • Sequence similarities
    Contains 2 GATA-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab112288 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab112288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up