Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHP ITTYPPYVPEYSSGLFPPSSLLGGSPTGFG
    • Molecular weight
      35 kDa including tags
    • Amino acids
      169 to 248

Specifications

Our Abpromise guarantee covers the use of ab114297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GATA 3
    • GATA binding factor 3
    • GATA binding protein 3
    • GATA-binding factor 3
    • Gata3
    • GATA3_HUMAN
    • HDR
    • HDRS
    • MGC2346
    • MGC5199
    • MGC5445
    • Trans acting T cell specific transcription factor GATA 3
    • Trans-acting T-cell-specific transcription factor GATA-3
    see all
  • Function
    Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificity
    T-cells and endothelial cells.
  • Involvement in disease
    Defects in GATA3 are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia (HDR) [MIM:146255]; also known as Barakat syndrome.
  • Sequence similarities
    Contains 2 GATA-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human GATA3 protein images

  • 12.5% SDS-PAGE image showing ab114297 at approx 34.54 kDa. Stained with Coomassie Blue.

References for Recombinant Human GATA3 protein (ab114297)

ab114297 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up