Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43694
    • SpeciesHuman
    • SequenceASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGH GPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
    • Molecular weight37 kDa
    • Amino acids343 to 442

Specifications

Our Abpromise guarantee covers the use of ab112289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • ASD2
    • GATA 4
    • GATA binding protein 4
    • GATA-binding factor 4
    • gata4
    • GATA4_HUMAN
    • MGC126629
    • Transcription factor GATA 4
    • Transcription factor GATA-4
    • Transcription factor GATA4
    • VSD1
    see all
  • FunctionTranscriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development (PubMed:24000169). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (By similarity). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (PubMed:20081228). Required during testicular development (PubMed:21220346). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (PubMed:15734735).
  • Involvement in diseaseAtrial septal defect 2
    Ventricular septal defect 1
    Tetralogy of Fallot
    Atrioventricular septal defect 4
    Testicular anomalies with or without congenital heart disease
    GATA4 mutations can predispose to dilated cardiomyopathy (CMD), a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similaritiesContains 2 GATA-type zinc fingers.
  • Post-translational
    modifications
    Methylation at Lys-300 attenuates transcriptional activity.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GATA4 protein images

  • ab112289 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GATA4 protein (ab112289)

ab112289 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"