Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPV MTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      496 to 595

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gata binding factor 6
    • Gata binding protein 6
    • GATA-binding factor 6
    • Gata6
    • GATA6_HUMAN
    • Transcription factor Gata 6
    • Transcription factor GATA-6
    see all
  • Function
    Thought to be important for regulating terminal differentiation and/or proliferation.
  • Tissue specificity
    Expressed in heart, gut and gut-derived tissues.
  • Sequence similarities
    Contains 2 GATA-type zinc fingers.
  • Domain
    The GATA-type zinc fingers mediate interaction with LMCD1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114316 on a 12.5% gel stained with Coomassie Blue.

References

ab114316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up