Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92908
    • SpeciesHuman
    • SequenceKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPV MTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
    • Molecular weight37 kDa including tags
    • Amino acids496 to 595

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gata binding factor 6
    • Gata binding protein 6
    • GATA-binding factor 6
    • Gata6
    • GATA6_HUMAN
    • Transcription factor Gata 6
    • Transcription factor GATA-6
    see all
  • FunctionThought to be important for regulating terminal differentiation and/or proliferation.
  • Tissue specificityExpressed in heart, gut and gut-derived tissues.
  • Sequence similaritiesContains 2 GATA-type zinc fingers.
  • DomainThe GATA-type zinc fingers mediate interaction with LMCD1.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Gata6 protein images

  • SDS-PAGE analysis of ab114316 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Gata6 protein (ab114316)

ab114316 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"