Overview

  • Product name
    Recombinant Human GBA2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETGGTKDVQVTDCKSPED SRPPKETDCCNPEDSGQLMVSYEGKAMGYQVPPFGWRICLAHEFTEKRKP FQANNVSLSNMIKHIGMGLRYLQWWYRKTHVEKKTPFIDMINSVPLRQIY GCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHRTVIADQFTVCLRREGQT VYQQVLSLERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLTC RQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDD APGGLWNEPFCLERSGETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHI TAFDPDSTGQQVWQDLLQDGQLDSPTGQSTPTQKGVGIAGAVCVSSKLRP RGQCRLEFSLAWDMPRIMFGAKGQVHYRRYTRFFGQDGDAAPALSHYALC RYAEWEERISAWQSPVLDDRSLPAWYKSALFNELYFLADGGTVWLEVLED SLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIML WPKLELSLQYDMALATLREDLTRRRYLMSGVMAPVKRRNVIPHDIGDPDD EPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLA VMESEMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMV QMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVM SDQCAGQWFLKACGLGEGDTEVFPTQHVVRALQTIFELNVQAFAGGAMGA VNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGCYR TVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASW PKVKQGTGLRTGPMFGPKEAMANLSPE
    • Amino acids
      1 to 927
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AD035
    • Beta glucocerebrosidase 2
    • Beta glucosidase 2
    • DKFZp762K054
    • glucosidase, beta (bile acid) 2
    • Glucosylceramidase 2
    • KIAA1605
    • MGC16895
    • NLGase
    • Non lysosomal glucosylceramidase
    • SPG46
    see all
  • Relevance
    GBA2 is a non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. It is involved in sphingomyelin generation and prevention of glycolipid accumulation. GBA2 may also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.
  • Cellular localization
    Cell membrane; Single-pass membrane protein. Note=Not localized to lipid rafts.

Images

  • ab163631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Berger Z  et al. Tool compounds robustly increase turnover of an artificial substrate by glucocerebrosidase in human brain lysates. PLoS One 10:e0119141 (2015). Read more (PubMed: 25763858) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up