Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYT SAKEYAKIIRNNGLEAH
    • Amino acids
      402 to 468
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBG
    • CBGL1
    • Cytosolic beta glucosidase
    • Cytosolic beta glucosidase like protein 1
    • Cytosolic beta-glucosidase
    • Cytosolic beta-glucosidase-like protein 1
    • GBA3
    • GBA3_HUMAN
    • GLUC
    • Glucosidase beta acid 3
    • Klotho related protein
    • KLRP
    see all
  • Function
    Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.
  • Tissue specificity
    Present in small intestine (at protein level). Expressed in liver, small intestine, colon, spleen and kidney. Down-regulated in renal cell carcinomas and hepatocellular carcinomas.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 1 family. Klotho subfamily.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab163648 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up