Overview

  • Product name
    Recombinant Human GBP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTG KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEG LGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTH RIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDE YLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQL EKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESL QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQ EASSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEE PRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQ ASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTL ALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
    • Molecular weight
      91 kDa including tags
    • Amino acids
      1 to 592

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GBP 1
    • GBP-1
    • GBP1
    • GBP1_HUMAN
    • GTP binding protein 1
    • GTP-binding protein 1
    • Guanine nucleotide binding protein 1
    • Guanine nucleotide-binding protein 1
    • Guanylate binding protein 1
    • Guanylate binding protein 1 interferon inducible
    • Guanylate binding protein 1 interferon inducible 67kDa
    • HuGBP 1
    • HuGBP-1
    • HuGBP1
    • Interferon induced guanylate binding protein 1
    • Interferon-induced guanylate-binding protein 1
    • OTTHUMP00000012352
    see all
  • Function
    Binds GTP, GDP and GMP.
  • Sequence similarities
    Belongs to the GBP family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human GBP1 protein images

  • 12.5% SDS-PAGE showing ab114960 at approximately 91.23kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GBP1 protein (ab114960)

ab114960 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up