Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43080
    • SpeciesHuman
    • SequenceMGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSP SASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYD VDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGE LSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAA G
    • Molecular weight48 kDa including tags
    • Amino acids1 to 201

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • COD3
    • GCAP
    • GCAP 1
    • Guanylate Cyclase Activating Protein Photoreceptor 1
    • Guanylate cyclase activator 1A
    • Guanylin 1
    • guanylyl cyclase activating protein 1
    • Guanylyl cyclase-activating protein 1
    • GUC1A_HUMAN
    • GUCA
    • GUCA1
    • GUCA1A
    see all
  • FunctionStimulates guanylyl cyclase 1 (GC1) when free calcium ions concentration is low and inhibits GC1 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure.
  • Tissue specificityRetina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments.
  • Involvement in diseaseDefects in GUCA1A are the cause of cone dystrophy type 3 (COD3) [MIM:602093]. COD3 is an autosomal dominant cone dystrophy. Cone dystrophies are retinal dystrophies characterized by progressive degeneration of the cone photoreceptors with preservation of rod function, as indicated by electroretinogram. However, some rod involvement may be present in some cone dystrophies, particularly at late stage. Affected individuals suffer from photophobia, loss of visual acuity, color vision and central visual field. Another sign is the absence of macular lesions for many years. Cone dystrophies are distinguished from the cone-rod dystrophies, in which some loss of peripheral vision also occurs.
  • Sequence similaritiesContains 4 EF-hand domains.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human GCAP1 protein images

  • 12.5% SDS-PAGE showing GCAP1 at approximately 47.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GCAP1 protein (ab117014)

ab117014 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"