Recombinant Human GCIP interacting protein p29 (ab113599)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNP DLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHG THVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNK KAERFYGKYTAEIKQNLERGTAV
    • Molecular weight
      21 kDa including tags
    • Amino acids
      94 to 243
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113599 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride, 0.08% DTT, 0.06% EDTA

General Info

  • Alternative names
    • CBPIN
    • CCNDBP1 interactor
    • CCNDBP1-interactor
    • DKFZp564O2082
    • fSAP29
    • Functional spliceosome associated protein 29
    • GCIP interacting protein p29
    • GCIPIP
    • NTC31
    • P29
    • Pre mRNA splicing factor SYF2
    • Pre-mRNA-splicing factor syf2
    • syf2
    • SYF2 homolog
    • SYF2 homolog RNA splicing factor
    • SYF2 homolog RNA splicing factor (S. cerevisiae)
    • SYF2_HUMAN
    see all
  • Function
    May be involved in pre-mRNA splicing.
  • Tissue specificity
    Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
  • Sequence similarities
    Belongs to the SYF2 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113599 at approximately 20.5 kDa (3 µg).

References

ab113599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up