Recombinant Human GCIP interacting protein p29 (ab113599)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95926
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNP DLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHG THVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNK KAERFYGKYTAEIKQNLERGTAV
    • Molecular weight21 kDa including tags
    • Amino acids94 to 243
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113599 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride, 0.08% DTT, 0.06% EDTA

General Info

  • Alternative names
    • CBPIN
    • CCNDBP1 interactor
    • CCNDBP1-interactor
    • DKFZp564O2082
    • fSAP29
    • Functional spliceosome associated protein 29
    • GCIP interacting protein p29
    • GCIPIP
    • NTC31
    • P29
    • Pre mRNA splicing factor SYF2
    • Pre-mRNA-splicing factor syf2
    • syf2
    • SYF2 homolog
    • SYF2 homolog RNA splicing factor
    • SYF2 homolog RNA splicing factor (S. cerevisiae)
    • SYF2_HUMAN
    see all
  • FunctionMay be involved in pre-mRNA splicing.
  • Tissue specificityAbundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
  • Sequence similaritiesBelongs to the SYF2 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GCIP interacting protein p29 images

  • 15% SDS-PAGE showing ab113599 at approximately 20.5 kDa (3 µg).

References for Recombinant Human GCIP interacting protein p29 (ab113599)

ab113599 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"