Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWM REFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVK YSGSKTDSSN
    • Molecular weight
      38 kDa including tags
    • Amino acids
      528 to 637
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • EC 6.3.2.2
    • Gamma ECS
    • Gamma glutamylcysteine synthetase
    • Gamma-ECS
    • Gamma-glutamylcysteine synthetase
    • GCL
    • Gclc
    • GCS
    • GCS heavy chain
    • GLCL
    • GLCLC
    • Glutamate cysteine ligase catalytic subunit
    • Glutamate--cysteine ligase catalytic subunit
    • GSH1_HUMAN
    see all
  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 1/2.
  • Involvement in disease
    Defects in GCLC are the cause of hemolytic anemia (HAGGSD) [MIM:230450].
  • Sequence similarities
    Belongs to the glutamate--cysteine ligase type 3 family.
  • Information by UniProt

Recombinant Human GCLC protein images

  • ab112294 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GCLC protein (ab112294)

ab112294 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up