Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKT LNEWSSQINPDLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVES NSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSLEHLQPYWEEL ENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL TAFAKQFDIQLLTHNDPKELLSGASFQEALQESIPDIQAHEWVPLWLLRY SVIVKSRGIIKSKGYILQAKRRGS
    • Molecular weight
      56 kDa including tags
    • Amino acids
      1 to 274

Specifications

Our Abpromise guarantee covers the use of ab114392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114392 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Gamma ECS regulatory subunit
    • Gamma-ECS regulatory subunit
    • Gamma-glutamylcysteine synthetase regulatory subunit
    • GCLM
    • GCS light chain
    • GLCLR
    • Glutamate cysteine ligase regulatory subunit
    • Glutamate--cysteine ligase modifier subunit
    • Glutamate--cysteine ligase regulatory subunit
    • GSC light chain
    • GSH0_HUMAN
    see all
  • Tissue specificity
    In all tissues examined. Highest levels in skeletal muscle.
  • Pathway
    Sulfur metabolism; glutathione biosynthesis; glutathione from L-cysteine and L-glutamate: step 1/2.
  • Sequence similarities
    Belongs to the aldo/keto reductase family. Glutamate--cysteine ligase light chain subfamily.
  • Information by UniProt

Recombinant Human GCLM protein images

  • ab114392 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human GCLM protein (ab114392)

ab114392 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up