Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAF NTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      730 to 829

Specifications

Our Abpromise guarantee covers the use of ab112408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • E2AK4_HUMAN
    • Eif2ak4
    • Eukaryotic Translation Initiation Factor 2 alpha kinase 4
    • Eukaryotic translation initiation factor 2-alpha kinase 4
    • GCN2
    • GCN2 eIF2alpha kinase
    • GCN2 like protein
    • GCN2-like protein
    • KIAA1338
    • MGCN2
    see all
  • Function
    Can phosphorylate the alpha subunit of EIF2 and may mediate translational control.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
    Contains 2 protein kinase domains.
    Contains 1 RWD domain.
  • Domain
    Kinase domain 1 is a degenerate kinase domain.
    RWD domain is reported to interact with GCN1L1.
  • Post-translational
    modifications
    Autophosphorylated on threonine residues.
  • Information by UniProt

Recombinant Human GCN2 protein images

  • 12.5% SDS-PAGE showing ab112408 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human GCN2 protein (ab112408)

ab112408 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up