Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAF NTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      730 to 829

Specifications

Our Abpromise guarantee covers the use of ab112408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • E2AK4_HUMAN
    • Eif2ak4
    • Eukaryotic Translation Initiation Factor 2 alpha kinase 4
    • Eukaryotic translation initiation factor 2-alpha kinase 4
    • GCN2
    • GCN2 eIF2alpha kinase
    • GCN2 like protein
    • GCN2-like protein
    • KIAA1338
    • MGCN2
    see all
  • Function
    Can phosphorylate the alpha subunit of EIF2 and may mediate translational control.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
    Contains 2 protein kinase domains.
    Contains 1 RWD domain.
  • Domain
    Kinase domain 1 is a degenerate kinase domain.
    RWD domain is reported to interact with GCN1L1.
  • Post-translational
    modifications
    Autophosphorylated on threonine residues.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112408 at approximately 36.63kDa stained with Coomassie Blue.

References

ab112408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up