Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15406
    • SpeciesHuman
    • SequenceMERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTNDR AEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVM SRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIE RIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELN GFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQSYSLIH QLLSAEDLE PLGTPMLIED GYAVTQAELF ALLCRLADEL LFRQIAWIKK LPFFCELSIK DYTCLLSSTW QELILLSSLT VYSKQIFGEL ADVTAKYSPS DEELHRFSDE GMEVIERLIY LYHKFHQLKV SNEEYACMKA INFLNQDIRG LTSASQLEQL NKRYWYICQD FTEYKYTHQP NRFPDLMMCL PEIRYIAGKM VNVPLEQLPL LFKVVLHSCK TSVGKE
    • Molecular weight81 kDa including tags
    • Amino acids1 to 475

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GCNF
    • GCNF 1
    • GCNF1
    • Germ cell nuclear factor
    • hGCNF
    • hRTR
    • NR 61
    • NR61
    • nr6a1
    • NR6A1_HUMAN
    • Nuclear receptor subfamily 6 group A member 1
    • Orphan nuclear receptor NR6A1
    • Retinoic acid receptor related testis associated receptor
    • Retinoid receptor related testis specific receptor
    • Retinoid receptor-related testis-specific receptor
    • RTR
    see all
  • FunctionOrphan nuclear receptor. Binds to a response element containing the sequence 5'-TCAAGGTCA-3'. May be involved in the regulation of gene expression in germ cell development during gametogenesis.
  • Tissue specificityShows highest expression in the germ cells of the adult testis.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR6 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human GCNF protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human GCNF protein (ab114813)

ab114813 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"