Overview

  • Product name
    Recombinant Human GCNT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAG ENPSSDINCTKVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDC SSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFY CIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSH KEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 428

Specifications

Our Abpromise guarantee covers the use of ab114895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-galactosyl-O-glycosyl-glycoprotein beta-1
    • 6-N-acetylglucosaminyltransferase
    • Beta-1
    • Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
    • C2GNT
    • C2GNT L
    • C2GNT1
    • C2GnTL
    • Core 2 branching enzyme
    • Core 2 GNT
    • Core 2-branching enzyme
    • Core2 GlcNAc transferase
    • Core2-GlcNAc-transferase
    • GCNT 1
    • GCNT1
    • GCNT1_HUMAN
    • glucosaminyl (N-acetyl) transferase 1 core 2
    • NACGT2
    see all
  • Function
    Forms critical branches in O-glycans.
  • Tissue specificity
    Highly expressed in activated T-lymphocytes and myeloid cells.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 14 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Recombinant Human GCNT1 protein images

  • 12.5% SDS-PAGE showing ab114895 at approximately 73.15kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GCNT1 protein (ab114895)

ab114895 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up