Overview

  • Product nameRecombinant Human GCNT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ02742
    • SpeciesHuman
    • SequenceMLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAG ENPSSDINCTKVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDC SSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFY CIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSH KEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH
    • Molecular weight73 kDa including tags
    • Amino acids1 to 428

Specifications

Our Abpromise guarantee covers the use of ab114895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-galactosyl-O-glycosyl-glycoprotein beta-1
    • 6-N-acetylglucosaminyltransferase
    • Beta-1
    • Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
    • C2GNT
    • C2GNT L
    • C2GNT1
    • C2GnTL
    • Core 2 branching enzyme
    • Core 2 GNT
    • Core 2-branching enzyme
    • Core2 GlcNAc transferase
    • Core2-GlcNAc-transferase
    • GCNT 1
    • GCNT1
    • GCNT1_HUMAN
    • glucosaminyl (N-acetyl) transferase 1 core 2
    • NACGT2
    see all
  • FunctionForms critical branches in O-glycans.
  • Tissue specificityHighly expressed in activated T-lymphocytes and myeloid cells.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyltransferase 14 family.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human GCNT1 protein images

  • 12.5% SDS-PAGE showing ab114895 at approximately 73.15kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GCNT1 protein (ab114895)

ab114895 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"