Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNG DLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
    • Amino acids
      303 to 402
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA360O19.2
    • bA421M1.1
    • Beta 1 6 N acetylglucosaminyltransferase 2
    • CCAT
    • GCNT 2
    • GCNT2C
    • GCNT5
    • Glucosaminyl (N acetyl) transferase 2 I branching enzyme
    • Glucosaminyl (N acetyl) transferase 2 I branching enzyme (I blood group)
    • I beta 1 6 N acetylglucosaminyltransferase
    • I branching beta 1 6 acetylglucosaminyltransferase
    • I branching enzyme
    • IGNT
    • II
    • Ii blood group
    • MGC163396
    • N acetylglucosaminyltransferase
    • N acetyllactosaminide beta 1 6 N acetylglucosaminyltransferase
    • N acetyllactosaminide beta 1,6 N acetylglucosaminyl transferase
    • NACGT1
    • NAGCT1
    • ULG3
    see all
  • Relevance
    GCNT2 is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase that converts linear into branched poly-N-acetyllactosaminoglycans and is responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding 3 different isoforms have been described.
  • Cellular localization
    Golgi apparatus membrane.

Images

  • ab158507 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up