Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLSFRLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKRSINCSGVTRGD QEAVLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSK
    • Amino acids
      28 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2010013H22Rik
    • 2210021I22Rik
    • 2210401J11Rik
    • 3-galactosyl-O-glycosyl-glycoprotein beta-1
    • 6-N-acetylglucosaminyltransferase
    • 6-N-acetylglucosaminyltransferase 3
    • Beta 1 3 galactosyl O glycosyl glycoprotein beta 1 6 N acetylglucosaminyltransferase 3
    • Beta-1
    • beta1 6 N acetylglucosaminyltransferase
    • Beta1 6 N acetylglucosaminyltransferase 3
    • C2/4GnT
    • C24GNT
    • C2GnT M
    • C2GnT mucin type
    • C2GnT-M
    • C2GnT-mucin type
    • C2GnT2
    • C2GNTM
    • Core 2 beta 1 6 N acetylglucosaminyltransferase II
    • Core 2/core 4 beta 1 6 N acetylglucosaminyltransferase
    • Core 2/core 4 beta-1
    • dI/C2/C4GnT
    • EC 2.4.1.102
    • EC 2.4.1.150
    • GCNT3
    • GCNT3_HUMAN
    • Glucosaminyl (N acetyl) transferase 3
    • Glucosaminyl (N acetyl) transferase 3 mucin type
    • glucosaminyl (N-acetyl) transferase 3, mucin type
    • GnT M
    • GNTM
    • hC2GnT M
    • hC2GnT-M
    • Mucus-type core 2 beta-1,6-N-acetylglucosaminyltransferase
    • OTTHUMP00000163601
    see all
  • Function
    Glycosyltransferase that can synthesize all known mucin beta 6 N-acetylglucosaminides. Mediates core 2 and core 4 O-glycan branching, 2 important steps in mucin-type biosynthesis. Has also I-branching enzyme activity by converting linear into branched poly-N-acetyllactosaminoglycans, leading to introduce the blood group I antigen during embryonic development.
  • Tissue specificity
    Primarily expressed in mucus-secreting tissues. Expressed in colon, kidney, small intestine, trachea, and stomach, where mucin is produced.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 14 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160400 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up