Recombinant human GCSF Receptor protein (ab168697)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGR QQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPA IPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSI LDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDV VKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQR GEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPS LELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVPLEEDSGRIQGYVVS WRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPTPVVF SESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSN KTWRMEQNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQE MAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSF SAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTP
    • Molecular weight
      69 kDa including tags
    • Amino acids
      25 to 621
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit the GCSF-induced proliferation of NFS-60 mouse myeloid cells. The ED50 for this effect is typically 0.02-2 µg/ml in the presence of 0.125 ng/ml of recombinant Human GCSF.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 250 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD 114
    • CD114
    • CD114 antigen
    • Colony stimulating factor 3 receptor
    • Colony stimulating factor 3 receptor (granulocyte)
    • CSF 3R
    • CSF3R
    • CSF3R_HUMAN
    • Csfgr
    • G CSF R
    • G-CSF receptor
    • G-CSF-R
    • GCSFR
    • Granulocyte colony stimulating factor receptor
    • Granulocyte colony-stimulating factor receptor
    • OTTHUMP00000009703
    • OTTHUMP00000009704
    • OTTHUMP00000009705
    see all
  • Function
    Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
  • Tissue specificity
    One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly expressed in placenta.
  • Involvement in disease
    Hereditary neutrophilia
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab168697 under reducing conditions and stained overnight with Coomassie Blue.

References

ab168697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up