Overview

  • Product name
    Recombinant Human GCSH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNF AQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEIN EALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
    • Molecular weight
      16 kDa including tags
    • Amino acids
      49 to 173
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113856 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • GCE
    • GCSH
    • GCSH_HUMAN
    • Glycine cleavage system H protein
    • Glycine cleavage system H protein mitochondrial
    • Glycine cleavage system protein H
    • Glycine cleavage system protein H (aminomethyl carrier)
    • Lipoic acid containing protein
    • mitochondrial
    • Mitochondrial glycine cleavage system H protein
    • NKH
    see all
  • Function
    The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.
  • Involvement in disease
    Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH) [MIM:605899]; also known as glycine encephalopathy (GCE). NKH is an autosomal recessive disease characterized by accumulation of a large amount of glycine in body fluid and by severe neurological symptoms.
  • Sequence similarities
    Belongs to the gcvH family.
    Contains 1 lipoyl-binding domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human GCSH protein images

  • 15% SDS-PAGE analysis of 3 µg ab113856.

References for Recombinant Human GCSH protein (ab113856)

ab113856 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up