Recombinant human GDF15 protein (ab50077)

Overview

Description

  • Nature
    Recombinant
  • Source
    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPS QFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQT YDDLLAKDCHCI
    • Amino acids
      197 to 308
    • Additional sequence information
      This product refers to the processed mature form of this protein from aa 195 to 308. Therefore it does not contain the signal peptide or propeptide.

Specifications

Our Abpromise guarantee covers the use of ab50077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osetoblast cells. The expected ED50 for this effect is 75-200 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    ab50077 purity was determined also by HPLC
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute to 1mg/ml with distilled water.

General Info

  • Alternative names
    • GDF 15
    • GDF-15
    • Gdf15
    • GDF15_HUMAN
    • Growth differentiation factor 15
    • Growth/differentiation factor 15
    • Macrophage inhibitory cytokine 1
    • MIC 1
    • Mic-1
    • MIC1
    • NAG 1
    • NAG-1
    • NAG1
    • NRG 1
    • NRG-1
    • NRG1
    • NSAID
    • NSAID (nonsteroidal anti inflammatory drug) activated protein 1
    • NSAID regulated protein 1
    • NSAID-activated gene 1 protein
    • NSAID-regulated gene 1 protein
    • PDF
    • PLAB
    • Placental bone morphogenetic protein
    • Placental bone morphogenic protein
    • Placental TGF beta
    • Placental TGF-beta
    • Prostate differentiation factor
    • PTGF beta
    • PTGFB
    see all
  • Tissue specificity
    Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant human GDF15 protein (ab50077)

ab50077 has not yet been referenced specifically in any publications.

Product Wall

I have received from the lab further information about ab50077. This product was lyophilized from 10 mM Sodium Citrate, pH 3.0.

I can confirm that the GDF15 protein ab50077 is naturally secreted by a proprietary cell line and then purified. No recombinant techniques are involved in the production of this protein.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up