Overview

  • Product name
    Recombinant Human GDF7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR
    • Molecular weight
      28 kDa
    • Amino acids
      322 to 450

Specifications

Our Abpromise guarantee covers the use of ab115505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    < 98 % SDS-PAGE.
    ab115505 is greater than 98% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Additional notes
    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.

General Info

  • Alternative names
    • bmp12
    • bone morphogenetic protein 12
    • GDF-7
    • Gdf7
    • GDF7_HUMAN
    • growth differentiation factor 7
    • Growth/differentiation factor 7
    see all
  • Function
    May play an active role in the motor area of the primate neocortex.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant Human GDF7 protein (ab115505)

ab115505 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up