Overview

  • Product name
    Recombinant Human GDF7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR
    • Molecular weight
      28 kDa
    • Amino acids
      322 to 450

Specifications

Our Abpromise guarantee covers the use of ab115505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    < 98 % SDS-PAGE.
    ab115505 is greater than 98% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Additional notes
    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.

General Info

  • Alternative names
    • bmp12
    • bone morphogenetic protein 12
    • GDF-7
    • Gdf7
    • GDF7_HUMAN
    • growth differentiation factor 7
    • Growth/differentiation factor 7
    see all
  • Function
    May play an active role in the motor area of the primate neocortex.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab115505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up