Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP50395
    • SpeciesHuman
    • SequenceQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTE SQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
    • Molecular weight37 kDa including tags
    • Amino acids346 to 445

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GDI-2
    • GDI2
    • GDIB_HUMAN
    • GDP dissociation inhibitor 2
    • Guanosine diphosphate dissociation inhibitor 2
    • Rab GDI beta
    • Rab GDP dissociation inhibitor beta
    • RABGDIB
    see all
  • FunctionRegulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the Rab GDI family.
  • Cellular localizationCytoplasm. Membrane.
  • Information by UniProt

Recombinant Human GDI2 protein images

  • ab114618 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human GDI2 protein (ab114618)

ab114618 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"