Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTE SQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
    • Molecular weight
      37 kDa including tags
    • Amino acids
      346 to 445

Specifications

Our Abpromise guarantee covers the use of ab114618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • GDI-2
    • GDI2
    • GDIB_HUMAN
    • GDP dissociation inhibitor 2
    • Guanosine diphosphate dissociation inhibitor 2
    • Rab GDI beta
    • Rab GDP dissociation inhibitor beta
    • RABGDIB
    see all
  • Function
    Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the Rab GDI family.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab114618 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up