Recombinant Human GDNF Receptor alpha 1 protein (ab158512)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLR QCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCL RIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCL DAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPA KHSYGMLFCSCRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYI CRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSS SLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQ PAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKS NVSGNTHLCISNGNYEKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTAL STLLSLTETS
    • Amino acids
      1 to 460
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GDNF family receptor alpha 1
    • GDNF family receptor alpha-1
    • GDNF R
    • GDNF RA
    • GDNF receptor alpha
    • GDNF receptor alpha-1
    • GDNFR
    • GDNFR alpha
    • GDNFR alpha 1
    • GDNFR-alpha-1
    • GDNFRA
    • GDNFRalpha
    • GFR alpha 1
    • GFR alpha1
    • GFR-alpha-1
    • GFRA 1
    • Gfra1
    • GFRA1_HUMAN
    • GFRalpha1
    • Glial cell line derived neurotrophic factor receptor alpha
    • GPI linked anchor protein
    • MGC23045
    • PI linked cell surface accessory protein
    • RET 1L
    • RET ligand 1
    • RET1L
    • RETL 1
    • RETL1
    • TGF beta related neurotrophic factor receptor 1
    • TGF-beta-related neurotrophic factor receptor 1
    • TRNR 1
    • TRNR1
    see all
  • Function
    Receptor for GDNF. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor.
  • Sequence similarities
    Belongs to the GDNFR family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158512 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up