Overview

  • Product name
    Recombinant Human GDPD5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTF TFGLTLTWLYFWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAY IAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMSAVAQLWEDEW EVLLISLQGTAPFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFF TVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRK ALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAK GNATLLLNLRDPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPL VRKVAPGFQQTSGSKEAVASLRRGHIQRLNLRYTQVSRQELRDYASWNLS VNLYTVNAPWLFSLLWCAGVPSVTSDNSHTLSQVPSPLWIMPPDEYCLMW VTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMK EKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI ERSGR
    • Amino acids
      1 to 605
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GDE2
    • Gdpd5
    • GDPD5_HUMAN
    • Glycerophosphodiester phosphodiesterase 2
    • Glycerophosphodiester phosphodiesterase domain containing 5
    • Glycerophosphodiester phosphodiesterase domain-containing protein 5
    • PP1665
    see all
  • Function
    Promotes neurite formation. Cooperates with PRDX1 to drive postmitotic motor neuron differentiation. The glycerophosphodiester phosphodiesterase activity may be required for its role in neuronal differentiation. May contribute to the osmotic regulation of cellular glycerophosphocholine.
  • Sequence similarities
    Belongs to the glycerophosphoryl diester phosphodiesterase family.
    Contains 1 GDPD domain.
  • Post-translational
    modifications
    Intramolecular disulfide bond between Cys-25 and Cys-571 is reduced by PRDX1.
  • Cellular localization
    Endomembrane system. Cytoplasm > perinuclear region. Cell projection > growth cone. In a punctate perinuclear pattern.
  • Information by UniProt

Images

  • ab164332 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up