Recombinant Human Gelsolin plasma protein (ab114279)

Overview

  • Product name
    Recombinant Human Gelsolin plasma protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPN SMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKT VQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQ GFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRA TEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDN ERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPD QTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIW RIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ DEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGG TSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAA YRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQG FEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
    • Molecular weight
      112 kDa including tags
    • Amino acids
      1 to 782
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Actin depolymerizing factor
    • ADF
    • AGEL
    • Brevin
    • Gelsolin
    see all
  • Relevance
    Gelsolin is a calcium regulated, actin modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed. It plays a role in phosphoinositide mediated disassembly of actin filaments in Sertoli cell adhesion complexes; it may regulate sperm release and turnover of the blood testis barrier [RGD], and severs actin filaments in the presence of submicromolar calcium, thereby solating cytoplasmic actin gels. A calcium independent mechanism reverses the process. Northern blot analysis suggested that a single gene encodes both cell and plasma gelsolins. This protein may be unique in that it is made for both secretion and intracytoplasmic location.
  • Cellular localization
    Secreted

Images

  • 12.5% SDS-PAGE analysis of ab114279 stained with Coomassie Blue.

References

ab114279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up