Recombinant Human Gelsolin protein (ab114280)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTE ALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDP LDRAMAELAA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      673 to 782

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Actin depolymerizing factor
    • Actin-depolymerizing factor
    • ADF
    • AGEL
    • Brevin
    • DKFZp313L0718
    • GELS_HUMAN
    • Gelsolin
    • Gsn
    see all
  • Function
    Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed. Plays a role in ciliogenesis.
  • Tissue specificity
    Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells.
  • Involvement in disease
    Defects in GSN are the cause of amyloidosis type 5 (AMYL5) [MIM:105120]; also known as familial amyloidosis Finnish type. AMYL5 is a hereditary generalized amyloidosis due to gelsolin amyloid deposition. It is typically characterized by cranial neuropathy and lattice corneal dystrophy. Most patients have modest involvement of internal organs, but severe systemic disease can develop in some individuals causing peripheral polyneuropathy, amyloid cardiomyopathy, and nephrotic syndrome leading to renal failure.
  • Sequence similarities
    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
  • Post-translational
    modifications
    Phosphorylation on Tyr-86, Tyr-409, Tyr-465, Tyr-603 and Tyr-651 in vitro is induced in presence of phospholipids.
  • Cellular localization
    Cytoplasm > cytoskeleton and Secreted.
  • Information by UniProt

Recombinant Human Gelsolin protein images

  • 12.5% SDS-PAGE analysis of ab114280. Stained with Coomassie Blue.

References for Recombinant Human Gelsolin protein (ab114280)

ab114280 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up