Recombinant Human Gemin 2 protein (ab152878)

Overview

  • Product name
    Recombinant Human Gemin 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQ EYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTL QWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLG EKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSN WFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDS KDDERVPALNLLICLVSRYFDQRDLADEPS
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 280

Specifications

Our Abpromise guarantee covers the use of ab152878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Component of gems 2
    • Gem (nuclear organelle) associated protein 2
    • Gem associated protein 2
    • GEMI2_HUMAN
    • Gemin-2
    • gemin2
    • SIP 1
    • SIP-1
    • SIP1
    • SIP1 delta
    • SIP1-delta
    • SMN interacting protein 1
    • SMN interacting protein 1 delta
    • SMN-interacting protein 1
    • Survival interacting protein 1
    • Survival of motor neuron protein interacting protein 1
    • Survival of motor neuron protein-interacting protein 1
    see all
  • Function
    The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
  • Sequence similarities
    Belongs to the gemin-2 family.
  • Cellular localization
    Nucleus > gem. Cytoplasm. Localized in subnuclear structures next to coiled bodies, called gems, which are highly enriched in spliceosomal snRNPs. Also found in the cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152878 stained with Coomassie Blue.

References

ab152878 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up