Recombinant Human GFAP protein (ab114149)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14136
    • SpeciesHuman
    • SequenceMERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE LNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLAT VRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNM HEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
    • Molecular weight74 kDa including tags
    • Amino acids1 to 432

Specifications

Our Abpromise guarantee covers the use of ab114149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114149 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • wu:fb34h11
    • ALXDRD
    • cb345
    • etID36982.3
    • FLJ42474
    • FLJ45472
    • GFAP
    • GFAP_HUMAN
    • gfapl
    • Glial fibrillary acidic protein
    • Intermediate filament protein
    • wu:fk42c12
    • xx:af506734
    • zgc:110485
    see all
  • FunctionGFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
  • Tissue specificityExpressed in cells lacking fibronectin.
  • Involvement in diseaseDefects in GFAP are a cause of Alexander disease (ALEXD) [MIM:203450]. Alexander disease is a rare disorder of the central nervous system. It is a progressive leukoencephalopathy whose hallmark is the widespread accumulation of Rosenthal fibers which are cytoplasmic inclusions in astrocytes. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death usually within the first decade. Infants with Alexander disease develop a leukoencephalopathy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Post-translational
    modifications
    Phosphorylated by PKN1.
  • Cellular localizationCytoplasm. Associated with intermediate filaments.
  • Information by UniProt

Recombinant Human GFAP protein images

  • 12.5% SDS-PAGE analysis of ab114149, stained with Coomassie Blue.
  • Anti-GFAP antibody - Astrocyte Marker (ab48050) at 1 µg/ml + Recombinant Human GFAP protein (ab114149) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References for Recombinant Human GFAP protein (ab114149)

ab114149 has not yet been referenced specifically in any publications.

Product Wall


With regards to ab114149, we don’t produce the protein with an endotoxin free system, so the recombinant protein is not endotoxin free.

Thank you very much for confirming the address.

I'm sending a free of charge vial of the protein on the order ***, which should arrive tomorrow.

I apologize again for this inconvenience, but please let me know if there is anything e...

Read More

Thank you very much for your reply and for the additional information.

Can you confirm the shipping address, and I will send you a free of charge vial of the protein?

I apologize for this inconvenience, but we do have another vial (...

Read More

Thank you so much for your call today and for your question about this protein.

I can confirm that this protein should have been received in a liquid state. I believe I found your order going to your institution, and it looks like you receive...

Read More

Thank you for contacting us. I apologize for the delay.

I have received retesting results for the lot you have had concerns. The results show the lot has a concentration of 0.33 mg/ml as mentioned on the datasheet and it shows very mice band ...

Read More

Thank you for contacting us.
Our lab has agreed to retest the conc. of in-stock vials. I will be able to provide you more feedback after I receive a reply from them.
Many thanks for having patience. I will get back to you soon.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"